PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn126761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 441aa    MW: 48200.7 Da    PI: 6.5943
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn126761genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32238293156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Achn126761 238 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 293
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.204235295IPR017930Myb domain
SuperFamilySSF466896.81E-17236296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-28236296IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26238293IPR006447Myb domain, plants
PfamPF002497.6E-7240291IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MMASPPELSL DCKPHSYSML LKLFGDQTDQ TQKLEDFLAR LEDERLKIDA FKRELPLCMQ  60
LLTNAMEASR QQLQTYRKDE GPVLEEFIPM KNSNSELGLE KDSNVSDMAS WMTSAQLWSP  120
ASDAAKQQMT ILTSPEEREI GFGVSPKLGF DNRQRNGGAF LPFSKEKNSG PSPTLALANS  180
GEEAGEEKKG LEGEHGNNGG GLRRESCVKV GVGEQGQGGN IPTDSQTNGA TGNQSHRKAR  240
RCWSPDLHRR FVNALQMLGG SQVATPKQIR ELMKVDGLTN DEVKSHLQKY RLHTRRPSPS  300
PQATGAPTPQ LVVLGGIWVP PEYASAAHGG APPTLYSTHP TTHAPPHYCT SQVPQEYYTT  360
PAAAAHHQLH HHALHHQLHM YHHGSPESDV RDGGNMSESM EDGKSESGSG GENGRGEKKG  420
LATLRDEREE SKGSEITLTF *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254263.10.0PREDICTED: probable transcription factor GLK2
TrEMBLB9STM70.0B9STM7_RICCO; Putative uncharacterized protein
STRINGVIT_11s0016g04600.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-118G2-like family protein